Easter Eggs

Easter Eggs is a Telegram NFT gift collection on the TON blockchain with 62 model variants. Its rarest model is Baby Chick, found in just 0.5% of mints. The collection launched on April 20, 2025.

The "Easter Eggs" collection features a delightful assortment of egg-shaped digital gifts, each containing a unique critter or festive symbol. From adorable bunnies to mythical creatures and charming baby animals hatching from their shells, the collection embodies the spirit of springtime and new beginnings. The diverse range of models offers collectors a chance to find their perfect Easter surprise.

Models (62)

Name	Tags	Rarity
Baby Chick	leafwoodbirdspringsweet	0.5%
Baby Turtle	turtlespringwaxsweetnature	0.5%
Choco Bunny	flowerglassspringfestivenature	0.5%
Cryptid	boxminecraftgamingluck	0.5%
Early Bird	eyewoodbirdspringfestivesweetnature	0.5%
Easter Bunny	leafflowerwoodspringfestivesweet	0.5%
Jurassic	leafspringnature	0.5%
Little Dino	flowerdragonstonespringfairy-talenature	0.5%
Little Doge	flowerwoodbirdspringsweetnature	0.5%
Red Whelp	jellygemcrystaldragonmagicwealth	0.5%
Sea Turtle	jellygemstarturtleglassspringfish	0.5%
Unicorn	unicornwoodbirdspringpastelnature	0.5%
Cactus	flowercactusspringsweetwhimsicalnatureceramic	1%
Chocolate	jellychocolatefoodsweet	1%
Deep Freeze	gemcrystalicewinterfestivegaming	1%
Dogel Mogel	dogchocolateplushmemefunny	1%
Egghead	eyeglassesfunny	1%
Faberge	gemcrystalspringelegantsweetluxuryart-deco	1%
Koshchei	eyespringmagicwhimsicalfairy-taleceramic	1%
Meowling	catheartsakurabellspring	1%
Pastel Candy	jellyboxcandyspringpastelsweetceramic	1%
Pearl	jellyfishnature	1%
Starry Gift	jellystarspring	1%
Dragon	jellygemcrystalbutterflydragonmagicfairy-tale	1.5%
Eggmoji	jellyhearteyelovefunny	1.5%
Foliage	jellyleafbutterflytreespringsweetnature	1.5%
Ice Cream	jellyice-creamcandyfruitspringfoodsweet	1.5%
Pure Gold	starelegantfestivesweetwealthluxury	1.5%
Stained Glass	butterflyglassspring	1.5%
Treasure Map	treewoodnature	1.5%
Boiled Pepe	pepeheartfroghatloveplushmemevalentine	2%
Chicken	birdminecraftsweetgaming	2%
Creeper	glassspringfestiveminecraftgaming	2%
Eggburger	jellyfoodsweetfunnygaming	2%
Eggsecutive	partybow-tieglassesfunny	2%
Fine Silver	gemcrystalstarmetalelegantwealthluxury	2%
Fish Pod	glassmetalfishgamingsci-fi	2%
Free Flight	springpastelTelegram Logo	2%
Jupiter	jellycrystalmoonstarringspacegaming	2%
Ladybird	beebutterflyspringnature	2%
Magic Key	gemmetalspringmagickeyfairy-tale	2%
Omeletron	crystalspacerocketmetalcyberpunkgamingsci-fisteampunk	2%
OS Shell	metalcyberpunkfunnygamingsci-fi	2%
Scrambull	jellycookiefoodsweet	2%
Stamper	starbonespringfood	2%
3D Render	jellyneonbutterflyspringsweet	2.5%
Ball of Steel	woodfirehelmetbellmetalsummergaming	2.5%
Brick Wall	butterflystonespringfestivesweetnature	2.5%
Bronze	starsweet	2.5%
Crown Prince	heartbutterflyspringmagicfestivesweetromantic	2.5%
Flower Bed	butterflyflowerspringfestive	2.5%
Flowers	butterflyflowerspringromantic	2.5%
Frosted	crystalbutterflyspringmagicsweetnature	2.5%
Gzhel	leafbutterflyflowerspringelegantwhimsicalnatureceramic	2.5%
Khokhloma	butterflyflowerwoodfruitspringsweetnatureceramic	2.5%
Matryoshka	butterflyflowerspringfestivesweetceramicchibi	2.5%
Meadow	beecookieflowerspringfestivesweet	2.5%
Moon Watch	moonwoodspacerocketstonesci-fi	2.5%
Mr. Benedict	jellybow-tiefoodsweetfunnyfashion	2.5%
Porcelain	butterflyflowerspringelegantnatureceramic	2.5%
Protein Lamp	glassspringlampfood	2.5%
Purple Bird	butterflyflowerbirdspringfestivesweetnature	2.5%